PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01489.1.g00160.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 389aa    MW: 41742.2 Da    PI: 11.2533
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01489.1.g00160.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.92.3e-274590146
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                                  k+ien +nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+l
  Zpz_sc01489.1.g00160.1.am.mk 45 KPIENATNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRL 90
                                  78******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.4693790IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-323796IPR002100Transcription factor, MADS-box
CDDcd002653.75E-333990No hitNo description
PRINTSPR004042.3E-263959IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-243991IPR002100Transcription factor, MADS-box
PfamPF003193.0E-244790IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-265974IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-267495IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MLNMMSQTDL SCCPSKVKEQ PAPANSGPSS GSTKPGIIRG RIEIKPIENA TNRQVTFCKR  60
RNGLLKKAYE LSVLCDAEVA LVVFSSRGRL TMPGACVALL QGSQKPKPMA AAAAAEEKRG  120
ACIASGDDTS KESWCLGGNA KSREAPLHVG VKATIERYKK ANSDSSNTGT VAEVNAQTTR  180
IIRLAVKQSK SRRGCWAKRC GAVDRPAAAQ PGMTSLWAGA SKWTGCSATT GQFSRRKKAT  240
GQAANRDGAR SPPASRCPLP SATSATLIRQ TSGRIRFHSR LAMHATRDDD LRPPLVGLLE  300
RHRLRRRGAV RAARCRGRER VADLLRGVGE PGAGHRVEXX XXFASASWML MFGPPNAPPL  360
PAALKKWPML LLGNRPPMAD QISIGCDLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-143990354Myocyte-specific enhancer factor 2B
1tqe_R2e-143990354Myocyte-specific enhancer factor 2B
1tqe_Q2e-143990354Myocyte-specific enhancer factor 2B
1tqe_P2e-143990354Myocyte-specific enhancer factor 2B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306377e-57AJ430637.1 Zea mays partial mRNA for putative MADS-domain transcription factor (m23 gene).
GenBankEU9608107e-57EU960810.1 Zea mays clone 228787 MADS-box transcription factor 3 mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3471634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.15e-34MIKC_MADS family protein